Product Number |
ARP32582_T100 |
Product Page |
www.avivasysbio.com/znf621-antibody-middle-region-arp32582-t100.html |
Name |
ZNF621 Antibody - middle region (ARP32582_T100) |
Protein Size (# AA) |
439 amino acids |
Molecular Weight |
49kDa |
NCBI Gene Id |
285268 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 621 |
Peptide Sequence |
Synthetic peptide located within the following region: ECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
Description of Target |
ZNF621 is a candidate transcription factor |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF621 (ARP32582_T100) antibody |
Blocking Peptide |
For anti-ZNF621 (ARP32582_T100) antibody is Catalog # AAP32582 (Previous Catalog # AAPP03585) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF621 |
Uniprot ID |
Q6ZSS3 |
Protein Name |
Zinc finger protein 621 |
Protein Accession # |
NP_940886 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_198484 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF621 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF621 Antibody Titration: 2.5ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|