| Product Number |
ARP32582_T100 |
| Product Page |
www.avivasysbio.com/znf621-antibody-middle-region-arp32582-t100.html |
| Name |
ZNF621 Antibody - middle region (ARP32582_T100) |
| Protein Size (# AA) |
439 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
285268 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 621 |
| Peptide Sequence |
Synthetic peptide located within the following region: ECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., et al., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
ZNF621 is a candidate transcription factor |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF621 (ARP32582_T100) antibody |
| Blocking Peptide |
For anti-ZNF621 (ARP32582_T100) antibody is Catalog # AAP32582 (Previous Catalog # AAPP03585) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZNF621 |
| Uniprot ID |
Q6ZSS3 |
| Protein Name |
Zinc finger protein 621 |
| Protein Accession # |
NP_940886 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_198484 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF621 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF621 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
