MKX Antibody - middle region (ARP32574_P050)

• Product Number: ARP32574_P050
• Name: MKX Antibody - middle region (ARP32574_P050)
• Protein Size (# AA): 352 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 283078
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Mohawk homeobox
• Alias Symbols: IFRX, IRXL1, C10orf48
• Peptide Sequence: Synthetic peptide located within the following region: IKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Anderson,D.M., (2006) Dev. Dyn. 235 (3), 792-801
• Description of Target: MKX contains 1 homeobox DNA-binding domain and belongs to the TALE/IRO homeobox family. It may act as a morphogenetic regulator of cell adhesion.
• Protein Interactions: HSP90AA1; ELAVL1; SIN3A; TBP; HDAC1; GTF2B; GTF2A1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-MKX (ARP32574_P050) antibody is Catalog # AAP32574 (Previous Catalog # AAPP03577)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MKX
• Uniprot ID: Q8IYA7
• Protein Name: Homeobox protein Mohawk
• Protein Accession #: NP_775847
• Purification: Affinity Purified
• Nucleotide Accession #: NM_173576
• Tested Species Reactivity: Human
• Gene Symbol: MKX
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%; Zebrafish: 85%
• Image 1: Human Stomach
  
  Human Stomach
• Image 2: Human HepG2
  
  Host: Rabbit
  Target Name: MKX
  Sample Tissue: Human HepG2
  Antibody Dilution: 1.0ug/ml