TAF5L Antibody - middle region (ARP32565_P050)

Data Sheet
 
Product Number ARP32565_P050
Product Page www.avivasysbio.com/taf5l-antibody-middle-region-arp32565-p050.html
Name TAF5L Antibody - middle region (ARP32565_P050)
Protein Size (# AA) 589 amino acids
Molecular Weight 66kDa
Subunit 5L
NCBI Gene Id 27097
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
Alias Symbols PAF65B
Peptide Sequence Synthetic peptide located within the following region: CVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ravnskjaer,K., (2007) EMBO J. 26 (12), 2880-2889
Description of Target TAF5L functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Protein Interactions HECW2; UBC; KAT2B; LSM11; TADA3; TAF10; ELAVL1; TSC22D1; TTR; H2AFX; CDKN1A; ANXA7; KAT2A; TP53; ATXN7; CEBPE; USP22; ATXN7L3; SUPT3H; TAF9; MYC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TAF5L (ARP32565_P050) antibody
Blocking Peptide For anti-TAF5L (ARP32565_P050) antibody is Catalog # AAP32565 (Previous Catalog # AAPP03568)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TAF5L
Uniprot ID O75529
Protein Name TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
Protein Accession # NP_055224
Purification Affinity Purified
Nucleotide Accession # NM_014409
Tested Species Reactivity Human
Gene Symbol TAF5L
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Stomach
WB Suggested Anti-TAF5L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Stomach
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com