FOXP1 Antibody - N-terminal region (ARP32564_T100)

• Product Number: ARP32564_T100
• Name: FOXP1 Antibody - N-terminal region (ARP32564_T100)
• Protein Size (# AA): 677 amino acids
• Molecular Weight: 75kDa
• NCBI Gene Id: 27086
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Forkhead box P1
• Alias Symbols: MFH, QRF1, 12CC4, hFKH1B, HSPC215
• Peptide Sequence: Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Shi,C., et al., (2004) J. Clin. Invest. 114 (3), 408-418
• Description of Target: FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).
• Protein Interactions: SUMO2; MYC; IL3RA; ELAVL1; NCOR2; GATAD2B; MTA1; FOXP1; FOXP4; FOXP2; CTBP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXP1 (ARP32564_T100) antibody is Catalog # AAP32564 (Previous Catalog # AAPP03567)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1
• Uniprot ID: Q9H334
• Protein Name: Forkhead box protein P1
• Publications:

  Jepsen, K., Gleiberman, A. S., Shi, C., Simon, D. I. & Rosenfeld, M. G. Cooperative regulation in development by SMRT and FOXP1. Genes Dev. 22, 740-5 (2008). 18347093

  Konstantoulas, C. J., Parmar, M. & Li, M. FoxP1 promotes midbrain identity in embryonic stem cell-derived dopamine neurons by regulating Pitx3. J. Neurochem. 113, 836-47 (2010). 20175877

  Tang, B. et al. Forkhead box protein p1 is a transcriptional repressor of immune signaling in the CNS: implications for transcriptional dysregulation in Huntington disease. Hum. Mol. Genet. 21, 3097-111 (2012). 22492998

• Protein Accession #: NP_116071
• Purification: Protein A purified
• Nucleotide Accession #: NM_032682
• Tested Species Reactivity: Human
• Gene Symbol: FOXP1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human Lung
  
  Human Lung
• Image 2: Human kidney
  
  Human kidney
• Image 3: Human Jurkat
  
  WB Suggested Anti-FOXP1 Antibody Titration: 0.5ug/ml
  Positive Control: Jurkat cell lysate