AKAP8L Antibody - middle region (ARP32560_P050)

Data Sheet
 
Product Number ARP32560_P050
Product Page www.avivasysbio.com/akap8l-antibody-middle-region-arp32560-p050.html
Name AKAP8L Antibody - middle region (ARP32560_P050)
Protein Size (# AA) 646 amino acids
Molecular Weight 72kDa
NCBI Gene Id 26993
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name A kinase (PRKA) anchor protein 8-like
Alias Symbols HA95, HAP95, NAKAP, NAKAP95
Peptide Sequence Synthetic peptide located within the following region: ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. It does not seem to be implicated in the binding of regulatory subunit II of PKA. It may be involved in nuclear envelope breakdown and chromatin condensation. It may regulate the initiation phase of DNA replication when associated with TMPO-beta.
Protein Interactions SUMO2; IRS4; UBC; RNF31; SUZ12; RNF2; BMI1; ANKRD28; HDAC11; ILK; vif; EPAS1; BARD1; CAND1; CUL1; CUL2; CUL3; EBNA-LP; Mis12; MYC; PRPF40A; AKAP8L; DHX9; CDC6; PRKACA; LBR; EMD; TMPO; RNF43; MAGED1; RELA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AKAP8L (ARP32560_P050) antibody
Blocking Peptide For anti-AKAP8L (ARP32560_P050) antibody is Catalog # AAP32560 (Previous Catalog # AAPP03563)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AKAP8L
Uniprot ID Q9ULX6
Protein Name A-kinase anchor protein 8-like
Protein Accession # NP_055186
Purification Affinity Purified
Nucleotide Accession # NM_014371
Tested Species Reactivity Human
Gene Symbol AKAP8L
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-AKAP8L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com