GATA3 Antibody - C-terminal region (ARP32548_T100)

• Product Number: ARP32548_T100
• Name: GATA3 Antibody - C-terminal region (ARP32548_T100)
• Protein Size (# AA): 444 amino acids
• Molecular Weight: 48kDa
• NCBI Gene Id: 2625
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: GATA binding protein 3
• Alias Symbols: HDR, HDRS
• Peptide Sequence: Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jee,YK., et al., (2005) J Biol Chem. 280(24), 23243-50
• Description of Target: GATA3 is crucially involved in IL-5 gene transcription in human peripheral CD4-positive t cells. This gene is involved in growth control and the maintenance of the differentiated state in epithelial cells and may contribute to tumorigenesis in breast cancer.
• Protein Interactions: PSMA3; FOXP3; USP21; UBC; SPI1; BRCA1; MYB; REPIN1; SP1; TBX21; HDAC5; HDAC4; HDAC3; RARB; MDM2; BMI1; MED1; ZFPM2; SATB1; TAL1; LMO1; LMO2; ETS2; ETS1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GATA3 (ARP32548_T100) antibody is Catalog # AAP32548
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GATA3
• Uniprot ID: Q5VWG7
• Protein Name: Trans-acting T-cell-specific transcription factor GATA-3
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that GATA3 is expressed in Jurkat

• Protein Accession #: NP_001002295
• Purification: Protein A purified
• Nucleotide Accession #: NM_001002295
• Tested Species Reactivity: Human
• Gene Symbol: GATA3
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: IF, IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%
• Image 1: Human Jurkat
  
  WB Suggested Antibody Titration: 0.2-1 ug/ml
  Positive Control: JurkatThere is BioGPS gene expression data showing that GATA3 is expressed in Jurkat
• Image 2: Human Jurkat
  
  WB Suggested Anti-GATA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GATA3 is expressed in Jurkat
• Image 3: Human Liver
  
  Rabbit Anti-GATA3 Antibody
  Catalog Number: ARP32548
  Paraffin Embedded Tissue: Human Liver
  Cellular Data: Hepatocyte
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X