GATA3 Antibody - C-terminal region (ARP32548_P050)

Data Sheet
 
Product Number ARP32548_P050
Product Page www.avivasysbio.com/gata3-antibody-c-terminal-region-arp32548-p050.html
Name GATA3 Antibody - C-terminal region (ARP32548_P050)
Protein Size (# AA) 443 amino acids
Molecular Weight 48kDa
NCBI Gene Id 2625
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name GATA binding protein 3
Alias Symbols HDR, HDRS
Peptide Sequence Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kaminuma,O., et al., (2004) FEBS Lett.570(1-3),63-68
Description of Target Trans-acting T-cell specific transcription factor GATA-3 is a member of GATA family of transcription factors that regulates development of multiple tissues. It is an important transcription factor in regulating human Th2 cell differentiation in vivo.
Protein Interactions PSMA3; FOXP3; USP21; UBC; SPI1; BRCA1; MYB; REPIN1; SP1; TBX21; HDAC5; HDAC4; HDAC3; RARB; MDM2; BMI1; MED1; ZFPM2; SATB1; TAL1; LMO1; LMO2; ETS2; ETS1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GATA3 (ARP32548_P050) antibody
Other Applications Image 1 Data Immunofluorescence --
Sample Type: Human Embryonic Stem Cell
Dilution: 1:250
Blocking Peptide For anti-GATA3 (ARP32548_P050) antibody is Catalog # AAP32548 (Previous Catalog # AAPP03551)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GATA3
Uniprot ID P23771
Protein Name Trans-acting T-cell-specific transcription factor GATA-3
Sample Type Confirmation

There is BioGPS gene expression data showing that GATA3 is expressed in Jurkat

Protein Accession # NP_002042
Purification Affinity Purified
Nucleotide Accession # NM_002051
Tested Species Reactivity Human
Gene Symbol GATA3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application IF, IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%
Image 1
Human Liver
Rabbit Anti-GATA3 Antibody Catalog Number: ARP32548 Paraffin Embedded Tissue: Human Liver Cellular Data: Hepatocyte Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X
Image 2
Human Jurkat
WB Suggested Anti-GATA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GATA3 is expressed in Jurkat
Image 3
Human Jurkat
WB Suggested Anti-GATA3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that GATA3 is expressed in Jurkat
Image 4
Human ESC
Sample Type : Human Embryonic Stem cell H1 differentiated to HNF4 positive hepatic progenitor cells
Dilution: 1:250
Data submitted by: Kirk Twaroski, Medical College of Wisconsin
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com