Product Number |
ARP32542_P050 |
Product Page |
www.avivasysbio.com/znf385-antibody-n-terminal-region-arp32542-p050.html |
Name |
ZNF385 Antibody - N-terminal region (ARP32542_P050) |
Protein Size (# AA) |
366 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
25946 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 385A |
Alias Symbols |
HZF, RZF, ZFP385, ZNF385 |
Peptide Sequence |
Synthetic peptide located within the following region: EPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sharma,S., et al., (2004) Gene 342 (2), 219-229 |
Description of Target |
ZNF385 is a new candidate transcription factor |
Protein Interactions |
CEP57; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF385A (ARP32542_P050) antibody |
Blocking Peptide |
For anti-ZNF385A (ARP32542_P050) antibody is Catalog # AAP32542 (Previous Catalog # AAPP03545) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF385 |
Uniprot ID |
Q96PM9 |
Protein Name |
Zinc finger protein 385A |
Protein Accession # |
NP_056296 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_015481 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF385A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
Image 1 | Human Lung
| Human Lung |
| Image 2 | Human brain
| WB Suggested Anti-ZNF385 Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain |
|
|