ZNF385 Antibody - N-terminal region (ARP32542_P050)

Data Sheet
 
Product Number ARP32542_P050
Product Page www.avivasysbio.com/znf385-antibody-n-terminal-region-arp32542-p050.html
Name ZNF385 Antibody - N-terminal region (ARP32542_P050)
Protein Size (# AA) 366 amino acids
Molecular Weight 38kDa
NCBI Gene Id 25946
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Zinc finger protein 385A
Alias Symbols HZF, RZF, ZFP385, ZNF385
Peptide Sequence Synthetic peptide located within the following region: EPAPTLGLFSNYSTMDPVQKAVLSHTFGGPLLKTKRPVISCNICQIRFNS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Sharma,S., et al., (2004) Gene 342 (2), 219-229
Description of Target ZNF385 is a new candidate transcription factor
Protein Interactions CEP57;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ZNF385A (ARP32542_P050) antibody
Blocking Peptide For anti-ZNF385A (ARP32542_P050) antibody is Catalog # AAP32542 (Previous Catalog # AAPP03545)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF385
Uniprot ID Q96PM9
Protein Name Zinc finger protein 385A
Protein Accession # NP_056296
Purification Affinity Purified
Nucleotide Accession # NM_015481
Tested Species Reactivity Human
Gene Symbol ZNF385A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Image 1
Human Lung
Human Lung
Image 2
Human brain
WB Suggested Anti-ZNF385 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com