POU2F3 Antibody - N-terminal region (ARP32537_P050)

Data Sheet
 
Product Number ARP32537_P050
Product Page www.avivasysbio.com/pou2f3-antibody-n-terminal-region-arp32537-p050.html
Name POU2F3 Antibody - N-terminal region (ARP32537_P050)
Protein Size (# AA) 436 amino acids
Molecular Weight 47 kDa
NCBI Gene Id 25833
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name POU class 2 homeobox 3
Alias Symbols PLA1, OCT11, PLA-1, Epoc-1, OCT-11, OTF-11, Skn-1a
Peptide Sequence Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Enomoto,Y., et al., (2004) Oncogene 23 (29), 5014-5022
Description of Target POU domain genes encode a family of highly conserved transacting factors that influence the transcriptional activity of several cell type-specific and ubiquitous genes.
Protein Interactions UBC; BCL6; CREBBP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
Datasheets/Manuals Printable datasheet for anti-POU2F3 (ARP32537_P050) antibody
Blocking Peptide For anti-POU2F3 (ARP32537_P050) antibody is Catalog # AAP32537 (Previous Catalog # AAPP03540)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
Uniprot ID Q9UKI9
Protein Name POU domain, class 2, transcription factor 3
Protein Accession # NP_055167
Purification Affinity Purified
Nucleotide Accession # NM_014352
Tested Species Reactivity Human, Mouse, Rat
Gene Symbol POU2F3
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Image 1
Rat Brain
Host: Rat
Target Name: POU2F3
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml
Image 2
Human Muscle
Human Muscle
Image 3
Human Skin
Rabbit Anti-POU2F3 antibody
Catalog Number: ARP32537
Formalin Fixed Paraffin Embedded Tissue: Human Skin
Primary antibody Concentration: 1:200
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
Image 4
Mouse tongue
Sample Type:
Mouse tongue tissue
Primary Antibody Dilution:
1:100
Secondary Antibody:
Anti-rabbit-Cy3
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Red: POU2F3
Gene Name:
POU2F3
Submitted by:
Dr. Hong Wang, Monell Chemical Senses Center
Image 5
Human HepG2
WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 6
Western Blot
25 ug of the indicated whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. N-terminal peptide also overlaps with isoform 3 at 39 kDa in some samples.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com