| Product Number |
ARP32523_P050 |
| Product Page |
www.avivasysbio.com/znf318-antibody-n-terminal-region-arp32523-p050.html |
| Name |
ZNF318 Antibody - N-terminal region (ARP32523_P050) |
| Protein Size (# AA) |
2099 amino acids |
| Molecular Weight |
232kDa |
| NCBI Gene Id |
24149 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 318 |
| Description |
|
| Alias Symbols |
TZF, ZFP318, HRIHFB2436 |
| Peptide Sequence |
Synthetic peptide located within the following region: SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Inoue,A., et al., (2000) Biophys. Res. Commun. 273 (2), 398-403 |
| Description of Target |
ZNF318 encodes a nuclear protein with a zinc finger motif of the Cys2-His2 type that is a novel corepressor of androgen receptor (AR). |
| Protein Interactions |
MDM2; MMS19; PPP1CC; ISG15; SIRT7; SUMO2; UBC; HDAC2; AR; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF318 (ARP32523_P050) antibody |
| Blocking Peptide |
For anti-ZNF318 (ARP32523_P050) antibody is Catalog # AAP32523 (Previous Catalog # AAPP03526) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF318 |
| Uniprot ID |
Q5VUA4 |
| Protein Name |
Zinc finger protein 318 |
| Protein Accession # |
NP_055160 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014345 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF318 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100% |
| Image 1 | Human Pancreas
 | Human Pancreas |
| | Image 2 | Human Stomach
 | WB Suggested Anti-ZNF318 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Stomach |
|
|
