| Product Number |
ARP32470_T100 |
| Product Page |
www.avivasysbio.com/suv39h1-antibody-c-terminal-region-arp32470-t100.html |
| Name |
SUV39H1 Antibody - C-terminal region (ARP32470_T100) |
| Protein Size (# AA) |
412 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
6839 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Suppressor of variegation 3-9 homolog 1 (Drosophila) |
| Description |
|
| Alias Symbols |
MG44, KMT1A, SUV39H, H3-K9-HMTase 1 |
| Peptide Sequence |
Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Frontelo,P., et al., (2004) Oncogene 23 (30), 5242-5251 |
| Description of Target |
SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su(var)3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
LZTS2; CEP70; HOOK2; CBX5; KRTAP10-7; HIST2H3A; CDCA4; KLHDC4; GTPBP2; ZNF581; ZCCHC17; CRBN; ING4; DCAF8; KLF15; KLHL20; PHF19; IL16; IGFBP4; ID2; ID1; HOXC4; HOXA1; FYN; FUS; EZH2; CLK3; ATP6V1B1; ATF3; GTF2H2C_2; H3F3C; LHX8; STX19; C17orf82; ZNF829; C |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SUV39H1 (ARP32470_T100) antibody |
| Blocking Peptide |
For anti-SUV39H1 (ARP32470_T100) antibody is Catalog # AAP32470 (Previous Catalog # AAPP03468) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SUV39H1 |
| Uniprot ID |
O43463 |
| Protein Name |
Histone-lysine N-methyltransferase SUV39H1 |
| Publications |
Enhanced levels of microRNA-125b in vascular smooth muscle cells of diabetic db/db mice lead to increased inflammatory gene expression by targeting the histone methyltransferase Suv39h1. Diabetes. 59, 2904-15 (2010). 20699419 |
| Sample Type Confirmation |
SUV39H1 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_003164 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_003173 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SUV39H1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SUV39H1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysateSUV39H1 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
| Image 2 | Human Lung
 | Rabbit Anti-SUV39H1 Antibody
Catalog Number: ARP32470
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 3 | Human Intestine
 | Human Intestine |
|
