NCOR2 Antibody - N-terminal region (ARP32463_P050)

Data Sheet
 
Product Number ARP32463_P050
Product Page www.avivasysbio.com/ncor2-antibody-n-terminal-region-arp32463-p050.html
Name NCOR2 Antibody - N-terminal region (ARP32463_P050)
Protein Size (# AA) 2524 amino acids
Molecular Weight 275kDa
NCBI Gene Id 9612
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nuclear receptor corepressor 2
Alias Symbols SMRT, TRAC, CTG26, SMRTE, TRAC1, N-CoR2, TNRC14, TRAC-1, SMAP270, SMRTE-tau
Peptide Sequence Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Keeton,E.K. (2005) Mol. Endocrinol. 19 (6), 1543-1554
Description of Target NCOR2 forms a large corepressor complex that contains SIN3A/B and histone deacetylases HDAC1 and HDAC2. This complex associates with the thyroid (TR) and the retinoid acid receptors (RAR) in the absence of ligand, and may stabilize their interaction with TFIIB. NCOR2 mediates the transcriptional repression activity of some nuclear receptors by promoting chromatin condensation, thus preventing access of the basal transcription.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Protein Interactions HDAC4; HDAC3; RARA; HMGA1; HDAC2; HDAC1; AURKA; BCL6; BCOR; GPS2; ZBTB16; UBC; E2F1; NR1I2; BTRC; HDAC7; NR1H2; THRA; RUNX1; Pparg; Nr2f1; Nr1i3; Nr2f2; CBX6; C1D; NR1H4; NR1D1; Ppard; SUMO2; CTBP1; ARNT; AHR; NCOR1; AR; NRD1; E2F4; ZBTB7A; SOX2; ESR1; CE
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NCOR2 (ARP32463_P050) antibody
Blocking Peptide For anti-NCOR2 (ARP32463_P050) antibody is Catalog # AAP32463 (Previous Catalog # AAPP03460)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR2
Uniprot ID Q9Y618
Protein Name Nuclear receptor corepressor 2
Sample Type Confirmation

NCOR2 is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_006303
Purification Affinity Purified
Nucleotide Accession # NM_006312
Tested Species Reactivity Human
Gene Symbol NCOR2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Pig, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 86%; Yeast: 87%; Zebrafish: 79%
Image 1
Human HeLa
WB Suggested Anti-NCOR2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysateNCOR2 is supported by BioGPS gene expression data to be expressed in HeLa
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com