Product Number |
ARP32463_P050 |
Product Page |
www.avivasysbio.com/ncor2-antibody-n-terminal-region-arp32463-p050.html |
Name |
NCOR2 Antibody - N-terminal region (ARP32463_P050) |
Protein Size (# AA) |
2524 amino acids |
Molecular Weight |
275kDa |
NCBI Gene Id |
9612 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Nuclear receptor corepressor 2 |
Alias Symbols |
SMRT, TRAC, CTG26, SMRTE, TRAC1, N-CoR2, TNRC14, TRAC-1, SMAP270, SMRTE-tau |
Peptide Sequence |
Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Keeton,E.K. (2005) Mol. Endocrinol. 19 (6), 1543-1554 |
Description of Target |
NCOR2 forms a large corepressor complex that contains SIN3A/B and histone deacetylases HDAC1 and HDAC2. This complex associates with the thyroid (TR) and the retinoid acid receptors (RAR) in the absence of ligand, and may stabilize their interaction with TFIIB. NCOR2 mediates the transcriptional repression activity of some nuclear receptors by promoting chromatin condensation, thus preventing access of the basal transcription.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests. |
Protein Interactions |
HDAC4; HDAC3; RARA; HMGA1; HDAC2; HDAC1; AURKA; BCL6; BCOR; GPS2; ZBTB16; UBC; E2F1; NR1I2; BTRC; HDAC7; NR1H2; THRA; RUNX1; Pparg; Nr2f1; Nr1i3; Nr2f2; CBX6; C1D; NR1H4; NR1D1; Ppard; SUMO2; CTBP1; ARNT; AHR; NCOR1; AR; NRD1; E2F4; ZBTB7A; SOX2; ESR1; CE |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NCOR2 (ARP32463_P050) antibody |
Blocking Peptide |
For anti-NCOR2 (ARP32463_P050) antibody is Catalog # AAP32463 (Previous Catalog # AAPP03460) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NCOR2 |
Uniprot ID |
Q9Y618 |
Protein Name |
Nuclear receptor corepressor 2 |
Sample Type Confirmation |
NCOR2 is supported by BioGPS gene expression data to be expressed in HeLa |
Protein Accession # |
NP_006303 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_006312 |
Tested Species Reactivity |
Human |
Gene Symbol |
NCOR2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Pig, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 86%; Yeast: 87%; Zebrafish: 79% |
Image 1 | Human HeLa
| WB Suggested Anti-NCOR2 Antibody Titration: 0.2-1 ug/ml Positive Control: Hela cell lysateNCOR2 is supported by BioGPS gene expression data to be expressed in HeLa |
|