SIRT4 Antibody - N-terminal region (ARP32452_P050)

Data Sheet
 
Product Number ARP32452_P050
Product Page www.avivasysbio.com/sirt4-antibody-n-terminal-region-arp32452-p050.html
Name SIRT4 Antibody - N-terminal region (ARP32452_P050)
Protein Size (# AA) 314 amino acids
Molecular Weight 35kDa
NCBI Gene Id 23409
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Sirtuin 4
Alias Symbols SIR2L4
Peptide Sequence Synthetic peptide located within the following region: ASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYAR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ahuja,N., (2007) J. Biol. Chem. 282 (46), 33583-33592
Description of Target SIRT4 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT4 is included in class IV of the sirtuin family. This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.
Protein Interactions SKP2; Glud1; UBC; SIRT3; IDE; SLC25A6; SLC25A5;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SIRT4 (ARP32452_P050) antibody
Blocking Peptide For anti-SIRT4 (ARP32452_P050) antibody is Catalog # AAP32452 (Previous Catalog # AAPP03448)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT4
Uniprot ID Q9Y6E7
Protein Name NAD-dependent protein deacetylase sirtuin-4
Protein Accession # NP_036372
Purification Affinity Purified
Nucleotide Accession # NM_012240
Tested Species Reactivity Human
Gene Symbol SIRT4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Image 1
Human HepG2
Host: Rabbit
Target Name: SIRT4
Sample Tissue: Human HepG2
Antibody Dilution: 1.0ug/ml
Image 2
HepG2, THP-1
Host: Rabbit
Target: SIRT4
Positive control (+): HepG2 (HG)
Negative control (-): THP-1 (N30)
Antibody concentration: 3ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com