OTX2 Antibody - N-terminal region (ARP32439_P050)

• Product Number: ARP32439_P050
• Name: OTX2 Antibody - N-terminal region (ARP32439_P050)
• Protein Size (# AA): 297 amino acids
• Molecular Weight: 32kDa
• NCBI Gene Id: 5015
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Orthodenticle homeobox 2
• Alias Symbols: CPHD6, MCOPS5
• Peptide Sequence: Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Takeda,K., et al., (2003) Proc. Biochem. Biophys. Res. Commun. 300(4),908-914
• Description of Target: Homeobox protein OTX2 is a member of the bicoid sub-family of homeodomain-containing transcription factors. This protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined. This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined.
• Protein Interactions: ATXN1; CDK4; APP; DMBX1; TLE4; FOXA2; MITF; OTX2; LHX1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-OTX2 (ARP32439_P050) antibody is Catalog # AAP32439 (Previous Catalog # AAPP03435)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OTX2
• Uniprot ID: P32243-2
• Protein Name: Homeobox protein OTX2
• Publications:

  Aluigi, M. G., Angelini, C., Corte, G. & Falugi, C. The sea urchin, Paracentrotus lividus, embryo as a “bioethical” model for neurodevelopmental toxicity testing: effects of diazinon on the intracellular distribution of OTX2-like proteins. Cell Biol. Toxicol. 24, 587-601 (2008). 18224450

  Machalińska, A. et al. Endogenous regeneration of damaged retinal pigment epithelium following low dose sodium iodate administration: an insight into the role of glial cells in retinal repair. Exp. Eye Res. 112, 68-78 (2013). 23623997

• Protein Accession #: NP_068374
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021728
• Tested Species Reactivity: Human
• Gene Symbol: OTX2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Image 1: Human Stomach
  
  Human Stomach
• Image 2: Human Heart
  
  Human Heart
• Image 3: Human Jurkat
  
  WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 4: Human Fetal Muscle
  
  Host: Rabbit
  Target Name: OTX2
  Sample Type: Human Fetal Muscle
  Antibody Dilution: 1.0ug/ml
• Image 5: Human Hela
  
  Host: Rabbit
  Target Name: OTX2
  Sample Type: Hela
  Antibody Dilution: 1.0ug/ml
• Image 6: Human MCF7
  
  Host: Rabbit
  Target Name: OTX2
  Sample Type: MCF7
  Antibody Dilution: 1.0ug/ml
• Image 7: Human Jurkat
  
  Host: Rabbit
  Target Name: OTX2
  Sample Type: Jurkat
  Antibody Dilution: 1.0ug/ml
• Image 8: Human HepG2
  
  Host: Rabbit
  Target Name: OTX2
  Sample Type: HepG2
  Antibody Dilution: 1.0ug/ml