| Product Number |
ARP32438_P050 |
| Product Page |
www.avivasysbio.com/eya2-antibody-middle-region-arp32438-p050.html |
| Name |
Eya2 Antibody - middle region (ARP32438_P050) |
| Protein Size (# AA) |
531 amino acids |
| Molecular Weight |
58kDa |
| NCBI Gene Id |
156826 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Eyes absent homolog 2 (Drosophila) |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: EAPHNVSQSSESLAGDYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Eya2 is a member of the eyes absent (EYA) family of proteins; may play a role in eye development; mouse homolog may act as a transcriptional activator. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Eya2 (ARP32438_P050) antibody |
| Blocking Peptide |
For anti-Eya2 (ARP32438_P050) antibody is Catalog # AAP32438 (Previous Catalog # AAPP03434) |
| Uniprot ID |
Q6UN47 |
| Protein Name |
Drosophila-type eyes absent 2-like protein EMBL AAQ72805.1 |
| Protein Accession # |
NP_569111 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_130427 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Eya2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Eya2 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
|
|
