BHLHB5 Antibody - N-terminal region (ARP32430_T100)

• Product Number: ARP32430_T100
• Name: BHLHB5 Antibody - N-terminal region (ARP32430_T100)
• Protein Size (# AA): 381 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 27319
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Basic helix-loop-helix family, member e22
• Alias Symbols: Beta3, BHLHB5, Beta3a, CAGL85, TNRC20
• Peptide Sequence: Synthetic peptide located within the following region: LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: McLellan,A.S., et al., Mech. Dev. 119 SUPPL 1, S285-S291 (2002)
• Description of Target: BHLHB5 is a member of family of basic helix-loop-helix (bHLH) transcription factors. Members of this family have been implicated in many aspects of neural development, including cell growth, differentiation, and cell migration.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-BHLHE22 (ARP32430_T100) antibody is Catalog # AAP32430
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5
• Uniprot ID: Q8NFJ8
• Protein Name: Class E basic helix-loop-helix protein 22
• Protein Accession #: NP_689627
• Purification: Protein A purified
• Nucleotide Accession #: NM_152414
• Tested Species Reactivity: Human
• Gene Symbol: BHLHE22
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-BHLHB5 Antibody
  Titration: 2.5 ug/ml
  Positive Control: Jurkat Whole Cell