DACH2 Antibody - C-terminal region (ARP32425_P050)

• Product Number: ARP32425_P050
• Name: DACH2 Antibody - C-terminal region (ARP32425_P050)
• Protein Size (# AA): 599 amino acids
• Molecular Weight: 65kDa
• NCBI Gene Id: 117154
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Dachshund homolog 2 (Drosophila)
• Peptide Sequence: Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Prueitt,R.L., et al., (2002) Cytogenet. Genome Res. 97 (1-2), 32-38
• Description of Target: Most X autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts the DACH2 gene.
• Protein Interactions: IRF9; KAT2B;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-DACH2 (ARP32425_P050) antibody is Catalog # AAP32425 (Previous Catalog # AAPP03420)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DACH2
• Uniprot ID: Q96NX9
• Protein Name: Dachshund homolog 2
• Protein Accession #: NP_444511
• Purification: Affinity Purified
• Nucleotide Accession #: NM_053281
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: DACH2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-DACH2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Mouse Liver
  
  Host: Mouse
  Target Name: DACH2
  Sample Tissue: Mouse Liver
  Antibody Dilution: 1ug/ml