Product Number |
ARP32425_P050 |
Product Page |
www.avivasysbio.com/dach2-antibody-c-terminal-region-arp32425-p050.html |
Name |
DACH2 Antibody - C-terminal region (ARP32425_P050) |
Protein Size (# AA) |
599 amino acids |
Molecular Weight |
65kDa |
NCBI Gene Id |
117154 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Dachshund homolog 2 (Drosophila) |
Peptide Sequence |
Synthetic peptide located within the following region: TKRKLQEALEFESKRREQVEQALKQATTSDSGLRMLKDTGIPDIEIENNG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Prueitt,R.L., et al., (2002) Cytogenet. Genome Res. 97 (1-2), 32-38 |
Description of Target |
Most X autosome translocations associated with premature ovarian failure do not interrupt X-linked genes. Only one of the six breakpoints disrupts the DACH2 gene. |
Protein Interactions |
IRF9; KAT2B; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DACH2 (ARP32425_P050) antibody |
Blocking Peptide |
For anti-DACH2 (ARP32425_P050) antibody is Catalog # AAP32425 (Previous Catalog # AAPP03420) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human DACH2 |
Uniprot ID |
Q96NX9 |
Protein Name |
Dachshund homolog 2 |
Protein Accession # |
NP_444511 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_053281 |
Tested Species Reactivity |
Human, Mouse |
Gene Symbol |
DACH2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-DACH2 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
| Image 2 | Mouse Liver
| Host: Mouse Target Name: DACH2 Sample Tissue: Mouse Liver Antibody Dilution: 1ug/ml |
|
|