Product Number |
ARP32416_P050 |
Product Page |
www.avivasysbio.com/neurod6-antibody-n-terminal-region-arp32416-p050.html |
Name |
NEUROD6 Antibody - N-terminal region (ARP32416_P050) |
Protein Size (# AA) |
337 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
63974 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Neuronal differentiation 6 |
Alias Symbols |
Nex1, Atoh2, MATH2, NEX1M, Math-2, bHLHa2 |
Peptide Sequence |
Synthetic peptide located within the following region: MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDRE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Scherer,S.W., (2003) Science 300 (5620), 767-772 |
Description of Target |
NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene. |
Protein Interactions |
UBC; HMGB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NEUROD6 (ARP32416_P050) antibody |
Blocking Peptide |
For anti-NEUROD6 (ARP32416_P050) antibody is Catalog # AAP32416 (Previous Catalog # AAPP03411) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human NEUROD6 |
Uniprot ID |
Q96NK8 |
Protein Name |
Neurogenic differentiation factor 6 |
Protein Accession # |
NP_073565 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022728 |
Tested Species Reactivity |
Human |
Gene Symbol |
NEUROD6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 79%; Rat: 100% |
Image 1 | Transfected 293T
| WB Suggested Anti-NEUROD6 Antibody Titration: 0.2-1 ug/ml Positive Control: Transfected 293T |
|
|