NEUROD6 Antibody - N-terminal region (ARP32416_P050)

Data Sheet
 
Product Number ARP32416_P050
Product Page www.avivasysbio.com/neurod6-antibody-n-terminal-region-arp32416-p050.html
Name NEUROD6 Antibody - N-terminal region (ARP32416_P050)
Protein Size (# AA) 337 amino acids
Molecular Weight 39kDa
NCBI Gene Id 63974
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Neuronal differentiation 6
Alias Symbols Nex1, Atoh2, MATH2, NEX1M, Math-2, bHLHa2
Peptide Sequence Synthetic peptide located within the following region: MCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEEEEEDRE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Scherer,S.W., (2003) Science 300 (5620), 767-772
Description of Target NEUROD6 contains 1 basic helix-loop-helix (bHLH) domain. It activates E box-dependent transcription in collaboration with TCF3/E47 and may be a trans-acting factor involved in the development and maintenance of the mammalian nervous system. It transactivates the promoter of its own gene.
Protein Interactions UBC; HMGB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NEUROD6 (ARP32416_P050) antibody
Blocking Peptide For anti-NEUROD6 (ARP32416_P050) antibody is Catalog # AAP32416 (Previous Catalog # AAPP03411)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NEUROD6
Uniprot ID Q96NK8
Protein Name Neurogenic differentiation factor 6
Protein Accession # NP_073565
Purification Affinity Purified
Nucleotide Accession # NM_022728
Tested Species Reactivity Human
Gene Symbol NEUROD6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 79%; Rat: 100%
Image 1
Transfected 293T
WB Suggested Anti-NEUROD6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com