NEUROD4 Antibody - middle region (ARP32415_P050)

• Product Number: ARP32415_P050
• Name: NEUROD4 Antibody - middle region (ARP32415_P050)
• Protein Size (# AA): 331 amino acids
• Molecular Weight: 37kDa
• NCBI Gene Id: 58158
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Neuronal differentiation 4
• Alias Symbols: ATH3, ATH-3, Atoh3, MATH3, MATH-3, bHLHa4
• Peptide Sequence: Synthetic peptide located within the following region: GHMETHLLHLKPQVFKSLGESSFGSHLPDCSTPPYEGPLTPPLSISGNFS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Horikawa,Y., (2000) Diabetes 49 (11), 1955-1957
• Description of Target: The specific function of the protein remains unknown.
• Protein Interactions: LRRN2; GABRB1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NEUROD4 (ARP32415_P050) antibody is Catalog # AAP32415 (Previous Catalog # AAPP03410)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NEUROD4
• Uniprot ID: B2RAC9
• Protein Name: Neurogenic differentiation factor 4
• Protein Accession #: NP_067014
• Purification: Affinity Purified
• Nucleotide Accession #: NM_021191
• Tested Species Reactivity: Human
• Gene Symbol: NEUROD4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 86%; Zebrafish: 100%
• Image 1: Human Spleen
  
  WB Suggested Anti-NEUROD4 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Spleen