| Product Number |
ARP32413_P050 |
| Product Page |
www.avivasysbio.com/neurog3-antibody-middle-region-arp32413-p050.html |
| Name |
Neurog3 Antibody - middle region (ARP32413_P050) |
| Protein Size (# AA) |
214 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
11925 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Neurogenin 3 |
| Alias Symbols |
ng, Ato, bHLH, ngn3, Atoh5, Math4, Math4B, bHLHa7 |
| Peptide Sequence |
Synthetic peptide located within the following region: NYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDWGSIYSPVSQA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Neurog3 (ARP32413_P050) antibody |
| Blocking Peptide |
For anti-Neurog3 (ARP32413_P050) antibody is Catalog # AAP32413 (Previous Catalog # AAPP03408) |
| Uniprot ID |
Q9D8I0 |
| Protein Name |
Putative uncharacterized protein EMBL BAB25411.1 |
| Protein Accession # |
NP_033849 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_009719 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Neurog3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 92%; Human: 100%; Mouse: 100%; Rabbit: 83%; Rat: 100% |
| Image 1 | Mouse Pancreas
 | WB Suggested Anti-Neurog3 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas |
|
|
