| Product Number |
ARP32391_T100 |
| Product Page |
http://www.avivasysbio.com/anti-sirt5-antibody-middle-region-arp32391-t100.html |
| Product Name |
SIRT5 antibody - middle region (ARP32391_T100) |
| Size |
100ug |
| Gene Symbol |
SIRT5 |
| Nucleotide Accession# |
NM_031244 |
| Protein Accession# |
NP_112534 |
| Protein Size (# AA) |
299 amino acids |
| Molecular Weight |
33kDa |
| Product Format |
Lyophilized powder |
| Purification |
Protein A purified |
| Clonality |
Polyclonal |
| Official Gene Full Name |
Sirtuin 5 |
| Alias Symbols |
SIR2L5 |
| Swissprot Id |
Q9NXA8 |
| NCBI Gene Id |
23408 |
| Host |
Rabbit |
| Description |
This is a rabbit polyclonal antibody against SIRT5. It was validated on Western Blot and immunohistochemistry by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com). |
| Peptide Sequence |
Synthetic peptide located within the following region: LSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILE |
| Key Reference |
Frye, R.A. et al., (2000) Res. Commun. 273 (2), 793-798 |
| Description of Target |
SIRT5 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. |
| Partner Proteins |
HIRA, UBC, Ubc |
| Reconstitution and Storage |
Add 100 μl of distilled water. Final anti-SIRT5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Lead Time |
Domestic: within 24 hours delivery
International: 3-5 business days |
| Blocking Peptide |
For anti-SIRT5 antibody is Catalog # AAP32391 (Previous Catalog # AAPP03381) |
| Immunogen |
The immunogen for anti-SIRT5 antibody: synthetic peptide directed towards the middle region of human SIRT5 |
| Complete computational species homology data |
SIRT5 antibody - middle region (ARP32391_T100) |
| Tissue Tool |
Find tissues and cell lines supported to express SIRT5.  |
| Reviews and Data |
Computational species homology for SIRT5 antibody (ARP32391); Product Protocols: SIRT5 antibody tested by IHC with human kidney (ARP32391); Product Protocols: SIRT5 antibody tested by IHC with human lung (ARP32391); Product Protocols: SIRT5 antibody teste |
| Homology Short |
Human, Pig, Mouse |
| Observed Species Reactivity |
Human, Mouse, Pig |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Pig: 84%; Mouse: 76% |
| Image 1 | Human Lung
 | |
|
| Image 2 | Human kidney
 | |
|
| Image 3 | Human Jurkat
 | WB Suggested Anti-SIRT5 Antibody Titration: 1.0-2.0ug/ml
Positive Control: Jurkat cell lysate |
|
