SIRT1 Antibody - N-terminal region (ARP32386_T100)

Data Sheet
 
Product Number ARP32386_T100
Product Page www.avivasysbio.com/sirt1-antibody-n-terminal-region-arp32386-t100.html
Name SIRT1 Antibody - N-terminal region (ARP32386_T100)
Protein Size (# AA) 747 amino acids
Molecular Weight 82kDa
NCBI Gene Id 23411
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Sirtuin 1
Description
Alias Symbols SIR2, SIR2L1, SIR2alpha
Peptide Sequence Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Solomon,J.M., et al., (2006) Mol. Cell. Biol. 26 (1), 28-38
Description of Target SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family.
Protein Interactions SIRT2; KAT5; IRS1; ING2; ING1; HSP90AA1; AR; EP300; CDK1; CCNB1; RPS19BP1; KAT8; CLOCK; IRS2; UBE2I; TP53; STK11; WRN; PPARGC1A; FOXO1; VHL; UBC; E2F1; PSME3; KCNA5; KCNA4; KCNAB2; POP1; PPARA; CAP1; KIAA1598; TPM4; FASN; CDKL1; HIC1; HDAC4; CHD3; CDK6; S
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SIRT1 (ARP32386_T100) antibody
Blocking Peptide For anti-SIRT1 (ARP32386_T100) antibody is Catalog # AAP32386 (Previous Catalog # AAPP03376)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SIRT1
Uniprot ID Q96EB6
Protein Name NAD-dependent protein deacetylase sirtuin-1
Publications

Ambient temperature influences aging in an annual fish (Nothobranchius rachovii). Aging Cell. 8, 726-37 (2009). 19780720

Dietary saturated fatty acids reduce hepatic lipid accumulation but induce fibrotic change in alcohol-fed rats. Hepatobiliary Surg Nutr. 4, 172-83 (2015). 26151057

Late-onset temperature reduction can retard the aging process in aged fish via a combined action of an anti-oxidant system and the insulin/insulin-like growth factor 1 signaling pathway. Rejuvenation Res. 17, 507-17 (2014). 25298234

Protein Accession # NP_036370
Purification Protein A purified
Nucleotide Accession # NM_012238
Tested Species Reactivity Human
Gene Symbol SIRT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Image 1
Human 786-0
Host: Rabbit
Target Name: SIRT1
Sample Tissue: Human 786-0
Antibody Dilution: 1.0ug/ml
Image 2

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com