SIX6 Antibody - N-terminal region (ARP32383_P050)

Data Sheet
 
Product Number ARP32383_P050
Product Page www.avivasysbio.com/six6-antibody-n-terminal-region-arp32383-p050.html
Name SIX6 Antibody - N-terminal region (ARP32383_P050)
Protein Size (# AA) 246 amino acids
Molecular Weight 28kDa
NCBI Gene Id 4990
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SIX homeobox 6
Alias Symbols Six9, ODRMD, OPTX2, MCOPCT2
Peptide Sequence Synthetic peptide located within the following region: PAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQAL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Aijaz,S., et al., (2004) Invest. Ophthalmol. Vis. Sci. 45 (11), 3871-3876
Description of Target SIX6 is a member of SIX family. It is the homologue of the chick Six6(Optx2) gene. SIX6 is closely related to SIX3 and is expressed in the developing and adult human retina.
Protein Interactions UBC; GTF2A1L; TLE1; AES;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SIX6 (ARP32383_P050) antibody
Blocking Peptide For anti-SIX6 (ARP32383_P050) antibody is Catalog # AAP32383 (Previous Catalog # AAPP03373)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SIX6
Uniprot ID O95475
Protein Name Homeobox protein SIX6
Protein Accession # NP_031400
Purification Affinity Purified
Nucleotide Accession # NM_007374
Tested Species Reactivity Human
Gene Symbol SIX6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Image 1
Human kidney
Human kidney
Image 2
Human Jurkat
WB Suggested Anti-SIX6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com