Product Number |
ARP32383_P050 |
Product Page |
www.avivasysbio.com/six6-antibody-n-terminal-region-arp32383-p050.html |
Name |
SIX6 Antibody - N-terminal region (ARP32383_P050) |
Protein Size (# AA) |
246 amino acids |
Molecular Weight |
28kDa |
NCBI Gene Id |
4990 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
SIX homeobox 6 |
Alias Symbols |
Six9, ODRMD, OPTX2, MCOPCT2 |
Peptide Sequence |
Synthetic peptide located within the following region: PAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQAL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Aijaz,S., et al., (2004) Invest. Ophthalmol. Vis. Sci. 45 (11), 3871-3876 |
Description of Target |
SIX6 is a member of SIX family. It is the homologue of the chick Six6(Optx2) gene. SIX6 is closely related to SIX3 and is expressed in the developing and adult human retina. |
Protein Interactions |
UBC; GTF2A1L; TLE1; AES; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SIX6 (ARP32383_P050) antibody |
Blocking Peptide |
For anti-SIX6 (ARP32383_P050) antibody is Catalog # AAP32383 (Previous Catalog # AAPP03373) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SIX6 |
Uniprot ID |
O95475 |
Protein Name |
Homeobox protein SIX6 |
Protein Accession # |
NP_031400 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_007374 |
Tested Species Reactivity |
Human |
Gene Symbol |
SIX6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
Image 1 | Human kidney
| Human kidney |
| Image 2 | Human Jurkat
| WB Suggested Anti-SIX6 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|