GLI1 Antibody - C-terminal region (ARP32368_T100)

Data Sheet
 
Product Number ARP32368_T100
Product Page www.avivasysbio.com/gli1-antibody-c-terminal-region-arp32368-t100.html
Name GLI1 Antibody - C-terminal region (ARP32368_T100)
Protein Size (# AA) 1106 amino acids
Molecular Weight 118 kDa
NCBI Gene Id 2735
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name GLI family zinc finger 1
Description
Alias Symbols GLI, PPD1, PAPA8
Peptide Sequence Synthetic peptide located within the following region: TNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Rahnama,F., et al., (2006) Biochem. J. 394 (PT 1), 19-26
Description of Target GLI1 is a protein which is a member of the Kruppel family of zinc finger proteins. The function of this gene has not been determined; however, it may play a role in normal development gene transcription. Mouse mutation studies indicate possible involvement in human foregut malformation.
Protein Interactions TRIM42; GCC1; PRKAA2; VHL; FEM1B; CDK4; UBC; MYC; ITCH; NUMB; SUFU; RAI1; XBP1; HDAC2; HDAC1; STK36; DYRK1A; ZIC2; ZIC1; Sin3a; Shh; SAP18; Su(fu); Pias1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-GLI1 (ARP32368_T100) antibody
Blocking Peptide For anti-GLI1 (ARP32368_T100) antibody is Catalog # AAP32368 (Previous Catalog # AAPP03357)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GLI1
Uniprot ID P08151
Protein Name Zinc finger protein GLI1
Publications

Bosco-Clément, G. et al. Targeting Gli transcription activation by small molecule suppresses tumor growth. Oncogene 33, 2087-97 (2014). 23686308

Chondrogenic differentiation of bone marrow-derived mesenchymal stem cells following transfection with Indian hedgehog and sonic hedgehog using a rotary cell culture system. Cell Mol Biol Lett. 24, 16 (2019). 30858866

Ferruzzi, P. et al. In vitro and in vivo characterization of a novel Hedgehog signaling antagonist in human glioblastoma cell lines. Int. J. Cancer 131, E33-44 (2012). 22072503

Iwata, J. et al. Modulation of lipid metabolic defects rescues cleft palate in Tgfbr2 mutant mice. Hum. Mol. Genet. 23, 182-93 (2014). 23975680

Maitah, M. Y., Ali, S., Ahmad, A., Gadgeel, S. & Sarkar, F. H. Up-regulation of sonic hedgehog contributes to TGF-beta1-induced epithelial to mesenchymal transition in NSCLC cells. PLoS One 6, e16068 (2011). 21249152

Ortega, M. C. et al. Megalin mediates the influence of sonic hedgehog on oligodendrocyte precursor cell migration and proliferation during development. Glia 60, 851-66 (2012). 22354480

Pandolfi, S. et al. WIP1 phosphatase modulates the Hedgehog signaling by enhancing GLI1 function. Oncogene 32, 4737-47 (2013). 23146903

Schiapparelli, P. et al. Inhibition of the sonic hedgehog pathway by cyplopamine reduces the CD133+/CD15+ cell compartment and the in vitro tumorigenic capability of neuroblastoma cells. Cancer Lett. 310, 222-31 (2011). 21803487

Yoshimura, K., Kawate, T. & Takeda, S. Signaling through the primary cilium affects glial cell survival under a stressed environment. Glia 59, 333-44 (2011). 21125655

Protein Accession # NP_005260
Purification Protein A purified
Nucleotide Accession # NM_005269
Tested Species Reactivity Human
Gene Symbol GLI1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
Host: Rabbit
Target Name: GLI1
Sample Tissue: Human Jurkat
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com