Product Number |
ARP32364_P050 |
Product Page |
www.avivasysbio.com/tbx19-antibody-middle-region-arp32364-p050.html |
Name |
TBX19 Antibody - middle region (ARP32364_P050) |
Protein Size (# AA) |
448 amino acids |
Molecular Weight |
48kDa |
NCBI Gene Id |
9095 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
T-box 19 |
Alias Symbols |
TPIT, TBS19, dJ747L4.1 |
Peptide Sequence |
Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Maira,M., et al., (2003) Bilodeau,S. J. Biol. Chem. 278 (47), 46523-46532 |
Description of Target |
TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
NR5A1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TBX19 (ARP32364_P050) antibody |
Blocking Peptide |
For anti-TBX19 (ARP32364_P050) antibody is Catalog # AAP32364 (Previous Catalog # AAPS31307) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TBX19 |
Uniprot ID |
O60806 |
Protein Name |
T-box transcription factor TBX19 |
Protein Accession # |
NP_005140 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005149 |
Tested Species Reactivity |
Human |
Gene Symbol |
TBX19 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 77% |
Image 1 | Human Jurkat
| WB Suggested Anti-TBX19 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|