TBX19 Antibody - middle region (ARP32364_P050)

Data Sheet
 
Product Number ARP32364_P050
Product Page www.avivasysbio.com/tbx19-antibody-middle-region-arp32364-p050.html
Name TBX19 Antibody - middle region (ARP32364_P050)
Protein Size (# AA) 448 amino acids
Molecular Weight 48kDa
NCBI Gene Id 9095
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name T-box 19
Alias Symbols TPIT, TBS19, dJ747L4.1
Peptide Sequence Synthetic peptide located within the following region: IKYNPFAKAFLDAKERNHLRDVPEAISESQHVTYSHLGGWIFSNPDGVCT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Maira,M., et al., (2003) Bilodeau,S. J. Biol. Chem. 278 (47), 46523-46532
Description of Target TBX19 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx19/Tpit gene. Studies in mouse show that Tpit protein is present only in the two pituitary pro-opiomelanocortin (POMC)-expressing lineages, the corticotrophs and melanotrophs. Mutations in the human ortholog were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage.This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Mutations in this gene were found in patients with isolated deficiency of pituitary POMC-derived ACTH, suggesting an essential role for this gene in differentiation of the pituitary POMC lineage. ACTH deficiency is characterized by adrenal insufficiency symptoms such as weight loss, lack of appetite (anorexia), weakness, nausea, vomiting, and low blood pressure. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions NR5A1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TBX19 (ARP32364_P050) antibody
Blocking Peptide For anti-TBX19 (ARP32364_P050) antibody is Catalog # AAP32364 (Previous Catalog # AAPS31307)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TBX19
Uniprot ID O60806
Protein Name T-box transcription factor TBX19
Protein Accession # NP_005140
Purification Affinity Purified
Nucleotide Accession # NM_005149
Tested Species Reactivity Human
Gene Symbol TBX19
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 77%
Image 1
Human Jurkat
WB Suggested Anti-TBX19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com