Product Number |
ARP32342_T100 |
Product Page |
www.avivasysbio.com/psmd4-antibody-n-terminal-region-arp32342-t100.html |
Name |
PSMD4 Antibody - N-terminal region (ARP32342_T100) |
Protein Size (# AA) |
377 amino acids |
Molecular Weight |
41kDa |
Subunit |
4 |
NCBI Gene Id |
5710 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Proteasome (prosome, macropain) 26S subunit, non-ATPase, 4 |
Alias Symbols |
AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5 |
Peptide Sequence |
Synthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wang,Q., (2005) J Mol Biol. 348(3), 727-39 |
Description of Target |
PSMD4 encodes one of the non-ATPase subunits of the 19S regulator lid which is part of a multicatalytic proteinase complex of the 26S proteasome. |
Protein Interactions |
UBC; cdc20; XPC; SPRTN; PSMD14; MDM2; PSMC2; PSMA1; ADRM1; UBQLN1; TXNL1; PSMD3; PSMD2; PSMD1; PSMC6; PSMC4; PSMC1; UCHL5; RPS12; PSMD8; UBQLN4; VCP; GJA1; DIO2; SCHIP1; FBXO6; PARK2; UL76; FBXO25; LOC100044627; Gm4705; LOC677113; Rps6-ps4; Rpl34-ps1; Rpl |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PSMD4 (ARP32342_T100) antibody |
Blocking Peptide |
For anti-PSMD4 (ARP32342_T100) antibody is Catalog # AAP32342 (Previous Catalog # AAPP03331) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4 |
Uniprot ID |
P55036 |
Protein Name |
26S proteasome non-ATPase regulatory subunit 4 |
Sample Type Confirmation |
PSMD4 is strongly supported by BioGPS gene expression data to be expressed in Raji |
Protein Accession # |
NP_002801 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_002810 |
Tested Species Reactivity |
Human |
Gene Symbol |
PSMD4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 79%; Zebrafish: 93% |
Image 1 | Human Raji
| WB Suggested Anti-PSMD4 Antibody Titration: 0.3ug/ml Positive Control: Raji cell lysatePSMD4 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells |
|