ID3 Antibody - N-terminal region (ARP32335_T100)

Data Sheet
 
Product Number ARP32335_T100
Product Page www.avivasysbio.com/id3-antibody-n-terminal-region-arp32335-t100.html
Name ID3 Antibody - N-terminal region (ARP32335_T100)
Protein Size (# AA) 119 amino acids
Molecular Weight 13kDa
NCBI Gene Id 3399
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Inhibitor of DNA binding 3, dominant negative helix-loop-helix protein
Description
Alias Symbols HEIR-1, bHLHb25
Peptide Sequence Synthetic peptide located within the following region: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tsuchiya,T., (2005) Cancer Sci. 96 (11), 784-790
Description of Target ID3 is a member of the ID family. The members of the family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.[supplied by OMIM].
Protein Interactions UBC; TCF12; TCF3; TCF4; FAM74A1; ZNF626; ZNF408; RND1; PUF60; ZNF3; MLX; CNOT3; ID3; GNB2; FHL2; CSK; ATF3; CDK2; SMURF2; PRDM14; CBFA2T2; SAP30; IKBKG; E2F4; GATA4; NKX2-5; ID4; GTF2A1L; ELK4; ELK1; SREBF1; PAX5; MYF6; MYF5; MYOG; MYOD1; IFI16; HES1; RUN
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ID3 (ARP32335_T100) antibody
Blocking Peptide For anti-ID3 (ARP32335_T100) antibody is Catalog # AAP32335 (Previous Catalog # AAPP03322)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ID3
Uniprot ID Q02535
Protein Name DNA-binding protein inhibitor ID-3
Publications

Inhibitor of differentiation 4 (Id4) is a potential tumor suppressor in prostate cancer. BMC Cancer. 9, 173 (2009). 19500415

Protein Accession # NP_002158
Purification Protein A purified
Nucleotide Accession # NM_002167
Tested Species Reactivity Human
Gene Symbol ID3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 93%; Sheep: 93%
Image 1
Transfected 293T
WB Suggested Anti-ID3 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com