EYA3 Antibody - middle region (ARP32331_P050)

Data Sheet
 
Product Number ARP32331_P050
Product Page www.avivasysbio.com/eya3-antibody-middle-region-arp32331-p050.html
Name EYA3 Antibody - middle region (ARP32331_P050)
Protein Size (# AA) 573 amino acids
Molecular Weight 63kDa
NCBI Gene Id 2140
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Eyes absent homolog 3 (Drosophila)
Peptide Sequence Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Borsani,G., et al., (1999) Hum.Mol.Genet.8(1),38679
Description of Target Eyes absent homolog 3 (EYA3) is a member of the eyes absent (EYA) family of proteins. This protein may act as a transcriptional activator and have a role during development. A similar protein in mice can act as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene.
Protein Interactions UBC; SKI; H2AFX; DACH1; SIX5; SIX4; SIX2; SIX1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-EYA3 (ARP32331_P050) antibody
Blocking Peptide For anti-EYA3 (ARP32331_P050) antibody is Catalog # AAP32331 (Previous Catalog # AAPP03318)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human EYA3
Uniprot ID Q99504
Protein Name Eyes absent homolog 3
Protein Accession # NP_001981
Purification Affinity Purified
Nucleotide Accession # NM_001990
Tested Species Reactivity Human
Gene Symbol EYA3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Sheep: 92%
Image 1
Human Skeletal Muscle
Human Skeletal Muscle
Image 2
Human HepG2
WB Suggested Anti-EYA3 Antibody Titration: 0.05-1.0ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com