Product Number |
ARP32331_P050 |
Product Page |
www.avivasysbio.com/eya3-antibody-middle-region-arp32331-p050.html |
Name |
EYA3 Antibody - middle region (ARP32331_P050) |
Protein Size (# AA) |
573 amino acids |
Molecular Weight |
63kDa |
NCBI Gene Id |
2140 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Eyes absent homolog 3 (Drosophila) |
Peptide Sequence |
Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Borsani,G., et al., (1999) Hum.Mol.Genet.8(1),38679 |
Description of Target |
Eyes absent homolog 3 (EYA3) is a member of the eyes absent (EYA) family of proteins. This protein may act as a transcriptional activator and have a role during development. A similar protein in mice can act as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Protein Interactions |
UBC; SKI; H2AFX; DACH1; SIX5; SIX4; SIX2; SIX1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-EYA3 (ARP32331_P050) antibody |
Blocking Peptide |
For anti-EYA3 (ARP32331_P050) antibody is Catalog # AAP32331 (Previous Catalog # AAPP03318) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human EYA3 |
Uniprot ID |
Q99504 |
Protein Name |
Eyes absent homolog 3 |
Protein Accession # |
NP_001981 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001990 |
Tested Species Reactivity |
Human |
Gene Symbol |
EYA3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Sheep: 92% |
Image 1 | Human Skeletal Muscle
| Human Skeletal Muscle |
| Image 2 | Human HepG2
| WB Suggested Anti-EYA3 Antibody Titration: 0.05-1.0ug/ml Positive Control: HepG2 cell lysate |
|
|