Product Number |
ARP32320_T100 |
Product Page |
www.avivasysbio.com/hnf1b-antibody-n-terminal-region-arp32320-t100.html |
Name |
HNF1B Antibody - N-terminal region (ARP32320_T100) |
Protein Size (# AA) |
399 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
6928 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
HNF1 homeobox B |
Alias Symbols |
T2D, FJHN, HNF2, LFB3, RCAD, TCF2, HPC11, LF-B3, MODY5, TCF-2, VHNF1, ADTKD3, HNF-1B, HNF1beta, HNF-1-beta |
Peptide Sequence |
Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wu,G., et al., (2004) J.Biochem.271(18),3715-3728 |
Description of Target |
Hepatocyte Nuclear Factor 1-. (HNF-1., Homeoprotein LFB3, Transcription factor 2, TCF2, Variant hepatic nuclear factor ) is a liver-specific factor of the homeobox-containing basic helix-turn-helix family. The TCF2 protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1; depending on the TCF2 isoform, the result may be to activate or inhibit transcription of target genes. Mutation of TCF2 that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5). A third human transcript variant is believed to exist based on such a variant in the rat: however, to date such an mRNA species has not been isolated. |
Protein Interactions |
HIST1H3A; PCBD1; CREBBP; HNF1A; ATF1; CREB1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HNF1B (ARP32320_T100) antibody |
Blocking Peptide |
For anti-HNF1B (ARP32320_T100) antibody is Catalog # AAP32320 (Previous Catalog # AAPP03307) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1B |
Protein Accession # |
NP_006472 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006481 |
Tested Species Reactivity |
Human, Rat |
Gene Symbol |
HNF1B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Jurkat
| WB Suggested Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat |
|
Image 2 | Rat Liver
| Host: Rat Target Name: HNF1B Sample Tissue: Rat Liver Antibody Dilution: 1ug/ml |
|