HNF1B Antibody - N-terminal region (ARP32320_P050)

Data Sheet
 
Product Number ARP32320_P050
Product Page www.avivasysbio.com/hnf1b-antibody-n-terminal-region-arp32320-p050.html
Name HNF1B Antibody - N-terminal region (ARP32320_P050)
Protein Size (# AA) 399 amino acids
Molecular Weight 45kDa
NCBI Gene Id 6928
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name HNF1 homeobox B
Alias Symbols T2D, FJHN, HNF2, LFB3, RCAD, TCF2, HPC11, LF-B3, MODY5, TCF-2, VHNF1, ADTKD3, HNF-1B, HNF1beta, HNF-1-beta
Peptide Sequence Synthetic peptide located within the following region: LETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPIL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wu,G., et al., (2004) J.Biochem.271(18),3715-3728
Description of Target Hepatocyte Nuclear Factor 1-. (HNF-1., Homeoprotein LFB3, Transcription factor 2, TCF2, Variant hepatic nuclear factor ) is a liver-specific factor of the homeobox-containing basic helix-turn-helix family. The TCF2 protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1; depending on the TCF2 isoform, the result may be to activate or inhibit transcription of target genes. Mutation of TCF2 that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5). A third human transcript variant is believed to exist based on such a variant in the rat: however, to date such an mRNA species has not been isolated.
Protein Interactions HIST1H3A; PCBD1; CREBBP; HNF1A; ATF1; CREB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HNF1B (ARP32320_P050) antibody
Specificity 100% specific to all three isoforms of HNF1B (61, 58, 45kD).
Blocking Peptide For anti-HNF1B (ARP32320_P050) antibody is Catalog # AAP32320 (Previous Catalog # AAPP03307)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1B
Uniprot ID P35680
Protein Name Hepatocyte nuclear factor 1-beta
Protein Accession # NP_006472
Purification Affinity Purified
Nucleotide Accession # NM_006481
Tested Species Reactivity Human, Rat
Gene Symbol HNF1B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Rat Liver
Host: Rat
Target Name: HNF1B
Sample Tissue: Rat Liver
Antibody Dilution: 1ug/ml
Image 2
Human Jurkat
WB Suggested Anti-HNF1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com