Product Number |
ARP32315_T100 |
Product Page |
www.avivasysbio.com/mmp19-antibody-c-terminal-region-arp32315-t100.html |
Name |
MMP19 Antibody - C-terminal region (ARP32315_T100) |
Protein Size (# AA) |
508 amino acids |
Molecular Weight |
56kDa |
NCBI Gene Id |
4327 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Matrix metallopeptidase 19 |
Alias Symbols |
CODA, MMP18, RASI-1 |
Peptide Sequence |
Synthetic peptide located within the following region: IHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Sadowski,T., et al., (2003) Mol. Biol. Cell 14 (11), 4569-4580 |
Description of Target |
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of the protein encoded by this gene has not been determined. This gene was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene. |
Protein Interactions |
ACAN; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-MMP19 (ARP32315_T100) antibody |
Blocking Peptide |
For anti-MMP19 (ARP32315_T100) antibody is Catalog # AAP32315 (Previous Catalog # AAPP03302) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human MMP19 |
Uniprot ID |
Q99542 |
Protein Name |
Matrix metalloproteinase-19 |
Protein Accession # |
NP_002420 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_002429 |
Tested Species Reactivity |
Human |
Gene Symbol |
MMP19 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93% |
Image 1 | Human urinary bladder
| Human urinary bladder |
|
Image 2 | Human Liver
| Human Liver |
|
Image 3 | Human HepG2
| WB Suggested Anti-MMP19 Antibody Titration: 5.0-10.0ug/ml Positive Control: HepG2 cell lysate |
|
Image 4 | Human
| Sample Type: Control-Human small intestine, Sample-Human colorectal cancerPrimary Antibody Dilution: 1:100Secondary Antibody: Biotinylated pig anti-rabbit+streptavidin-HRPColor/Signal Descriptions: MMP19: Brown DAPI:BlueGene Name: MMP19 Submitted by: Department of Pathology, Hospital de Carabineros de Chile, Santiago, Chile |
|