FOXE3 Antibody - C-terminal region (ARP32304_P050)

• Product Number: ARP32304_P050
• Name: FOXE3 Antibody - C-terminal region (ARP32304_P050)
• Protein Size (# AA): 319 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 2301
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Forkhead box E3
• Alias Symbols: AAT11, ASGD2, FKHL12, FREAC8, CTRCT34
• Peptide Sequence: Synthetic peptide located within the following region: PEPPCCAAPDAAAAAFPPCAAAASPPLYSQVPDRLVLPATRPGPGPLPAE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Blixt,A., et al., (2000) Eur.andGenesDev.14(2),245-254
• Description of Target: Forkhead Box Protein E3 (FOXE3, forkhead-related protein FKHL12, forkhead-related transcription factor 8) is a forkhead/winged helix transcription factor, which is expressed in the developing lens from the start of lens placode induction and becomes restricted to the anterior proliferating cells when lens fiber differentiation begins.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-FOXE3 (ARP32304_P050) antibody is Catalog # AAP32304 (Previous Catalog # AAPP03287)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FOXE3
• Uniprot ID: Q13461
• Protein Name: Forkhead box protein E3
• Protein Accession #: NP_036318
• Purification: Affinity Purified
• Nucleotide Accession #: NM_012186
• Tested Species Reactivity: Human
• Gene Symbol: FOXE3
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human Spermatophore
  
  Human Spermatophore
• Image 2: Human Muscle
  
  Human Muscle
• Image 3: Human HepG2
  
  WB Suggested Anti-FOXE3 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate