SKIIP Antibody - N-terminal region (ARP32294_P050)

Data Sheet
 
Product Number ARP32294_P050
Product Page www.avivasysbio.com/skiip-antibody-n-terminal-region-arp32294-p050.html
Name SKIIP Antibody - N-terminal region (ARP32294_P050)
Protein Size (# AA) 536 amino acids
Molecular Weight 61kDa
NCBI Gene Id 22938
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SNW domain containing 1
Alias Symbols Bx42, SKIP, FUN20, Prp45, SKIIP, SKIP1, PRPF45, NCOA-62
Peptide Sequence Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Figueroa,J.D., et al., (2004) Eur.Res.Commun.319(4),1105-1109
Description of Target SKIIP (Nuclear Protein SkiP, nuclear receptor coactivator NCoA-62, ski-interacting protein) is a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also interact with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity.
Protein Interactions TRAF1; GOLGA2; KRT40; LZTS2; RINT1; TEX11; CEP55; PPIL1; TFIP11; MTUS2; IKZF1; TP53; TUBGCP3; AURKB; UBC; SUZ12; RNF2; BMI1; HECW2; HDAC11; Dlg4; TTC14; ZNF830; SNIP1; CXorf56; XAB2; CTNNBL1; SART1; NHP2L1; MFAP1; EIF4A3; MAGOH; DHX15; DDX5; PABPC1; SKIV2
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SNW1 (ARP32294_P050) antibody
Blocking Peptide For anti-SNW1 (ARP32294_P050) antibody is Catalog # AAP32294 (Previous Catalog # AAPP03276)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human SKIIP
Uniprot ID Q13573
Protein Name SNW domain-containing protein 1
Sample Type Confirmation

SNW1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_036377
Purification Affinity Purified
Nucleotide Accession # NM_012245
Tested Species Reactivity Human
Gene Symbol SNW1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%
Image 1
Human Jurkat
WB Suggested Anti-SKIIP Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateSNW1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
Image 2
Human Lung
Rabbit Anti-SKIIP antibody
Catalog Number: ARP32294_P050
Paraffin Embedded Tissue: Human Lung cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 3
Human Intestine
Human Intestine
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com