Product Number |
ARP32290_T100 |
Product Page |
www.avivasysbio.com/znf365-antibody-n-terminal-region-arp32290-t100.html |
Name |
ZNF365 Antibody - N-terminal region (ARP32290_T100) |
Protein Size (# AA) |
333 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
22891 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 365 |
Alias Symbols |
UAN, Su48, ZNF365D |
Peptide Sequence |
Synthetic peptide located within the following region: DHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKP |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gianfrancesco,F., et al., (2003) Am. J. Hum. Genet. 72 (6), 1479-1491 |
Description of Target |
ZNF365 is located on chromosome 10. |
Protein Interactions |
APP; DISC1; NDE1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF365 (ARP32290_T100) antibody |
Blocking Peptide |
For anti-ZNF365 (ARP32290_T100) antibody is Catalog # AAP32290 |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF365 |
Uniprot ID |
Q70YC6 |
Protein Name |
Protein ZNF365 |
Protein Accession # |
NP_955522 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_199450 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF365 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human HepG2
| WB Suggested Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 |
| Image 2 | Human Liver
| Rabbit Anti-ZNF365 Antibody Catalog Number: ARP32290 Paraffin Embedded Tissue: Human Liver Cellular Data: Hepatocyte Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
| Image 3 | Human HepG2
|
WB Suggested Anti-ZNF365 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
|
|