| Product Number |
ARP32290_P050 |
| Product Page |
www.avivasysbio.com/znf365-antibody-n-terminal-region-arp32290-p050.html |
| Name |
ZNF365 Antibody - N-terminal region (ARP32290_P050) |
| Protein Size (# AA) |
333 amino acids |
| Molecular Weight |
36kDa |
| NCBI Gene Id |
22891 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 365 |
| Alias Symbols |
UAN, Su48, ZNF365D |
| Peptide Sequence |
Synthetic peptide located within the following region: DHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Gianfrancesco,F.,et al.,(2003) Am.J.Hum.Genet.72(6),1479-1491 |
| Description of Target |
Zinc Finger Protein 365 Isoform B (ZNF365) is a new candidate transcription factor. |
| Protein Interactions |
APP; DISC1; NDE1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF365 (ARP32290_P050) antibody |
| Blocking Peptide |
For anti-ZNF365 (ARP32290_P050) antibody is Catalog # AAP32290 (Previous Catalog # AAPP03272) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF365 |
| Uniprot ID |
Q70YC5 |
| Protein Name |
Protein ZNF365 |
| Protein Accession # |
NP_955522 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_199450 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF365 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human HepG2
 | WB Suggested Antibody
Titration: 0.2-1 ug/ml
Positive Control: HepG2 |
| | Image 2 | Human HepG2
 | WB Suggested Anti-ZNF365 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate |
| | Image 3 | Human Liver
 | Rabbit Anti-ZNF365 Antibody
Catalog Number: ARP32290
Paraffin Embedded Tissue: Human Liver
Cellular Data: Hepatocyte
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
|
