TFEC Antibody - N-terminal region (ARP32279_P050)

• Product Number: ARP32279_P050
• Name: TFEC Antibody - N-terminal region (ARP32279_P050)
• Protein Size (# AA): 318 amino acids
• Molecular Weight: 35kDa
• NCBI Gene Id: 22797
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Transcription factor EC
• Alias Symbols: TCFEC, TFE-C, TFECL, TFEC-L, bHLHe34, hTFEC-L
• Peptide Sequence: Synthetic peptide located within the following region: MESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mansky,K.C., (2002) J. Leukoc. Biol. 71 (2), 304-310
• Description of Target: TFEC is an activator of transcription with two separate activation domains.
• Protein Interactions: DEFB127; NAPB; ZMAT2; HNRNPA1; DCK; TFEC; TFEB; TFE3; MITF;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-TFEC (ARP32279_P050) antibody is Catalog # AAP32279 (Previous Catalog # AAPP23960)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TFEC
• Uniprot ID: Q5H9U8
• Protein Name: Transcription factor EC
• Protein Accession #: NP_001018068
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001018058
• Tested Species Reactivity: Human
• Gene Symbol: TFEC
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-TFEC Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate