ETV5 Antibody - N-terminal region (ARP32264_P050)

Data Sheet
 
Product Number ARP32264_P050
Product Page www.avivasysbio.com/etv5-antibody-n-terminal-region-arp32264-p050.html
Name ETV5 Antibody - N-terminal region (ARP32264_P050)
Protein Size (# AA) 510 amino acids
Molecular Weight 58kDa
NCBI Gene Id 2119
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ets variant 5
Alias Symbols ERM
Peptide Sequence Synthetic peptide located within the following region: AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Degerny,C., (2005) J. Biol. Chem. 280 (26), 24330-24338
Description of Target ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer
Protein Interactions RFWD2; HDAC11; DHRS7; SEZ6L2; SLC22A2; HOXD9; CYP3A5; CCR5; CISH; AMH; APP; BRCA1; ELAVL1; SUMO2; UBC; AR;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ETV5 (ARP32264_P050) antibody
Blocking Peptide For anti-ETV5 (ARP32264_P050) antibody is Catalog # AAP32264 (Previous Catalog # AAPP03245)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ETV5
Uniprot ID P41161
Protein Name ETS translocation variant 5
Protein Accession # NP_004445
Purification Affinity Purified
Nucleotide Accession # NM_004454
Tested Species Reactivity Human
Gene Symbol ETV5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human 293T
WB Suggested Anti-ETV5 Antibody Titration: 0.2-1 ug/ml
Positive Control: 293T cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com