NR2F6 Antibody - N-terminal region (ARP32256_T100)

• Product Number: ARP32256_T100
• Name: NR2F6 Antibody - N-terminal region (ARP32256_T100)
• Protein Size (# AA): 404 amino acids
• Molecular Weight: 43kDa
• NCBI Gene Id: 2063
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Nuclear receptor subfamily 2, group F, member 6
• Alias Symbols: EAR2, EAR-2, ERBAL2
• Peptide Sequence: Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily
• Protein Interactions: NSD1; BCL11A; CBX1; NAP1L1; UBC; TFAP4; NR2F2; THRB; ANGPTL1; NCOA1; NR3C1; ESR1; NR2F6; RARG; RXRA;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NR2F6 (ARP32256_T100) antibody is Catalog # AAP32256 (Previous Catalog # AAPP03237)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6
• Uniprot ID: P10588
• Protein Name: Nuclear receptor subfamily 2 group F member 6
• Sample Type Confirmation:

  NR2F6 is strongly supported by BioGPS gene expression data to be expressed in HepG2

• Protein Accession #: NP_005225
• Purification: Protein A purified
• Nucleotide Accession #: NM_005234
• Tested Species Reactivity: Human
• Gene Symbol: NR2F6
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 87%; Rat: 87%
• Image 1: Human HepG2
  
  WB Suggested Anti-NR2F6 Antibody
  Titration: 5 ug/ml
  Positive Control: HepG2 Whole CellNR2F6 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells