NR2F6 Antibody - N-terminal region (ARP32256_P050)

Data Sheet
 
Product Number ARP32256_P050
Product Page www.avivasysbio.com/nr2f6-antibody-n-terminal-region-arp32256-p050.html
Name NR2F6 Antibody - N-terminal region (ARP32256_P050)
Protein Size (# AA) 404 amino acids
Molecular Weight 43kDa
NCBI Gene Id 2063
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Nuclear receptor subfamily 2, group F, member 6
Alias Symbols EAR2, EAR-2, ERBAL2
Peptide Sequence Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily
Protein Interactions NSD1; BCL11A; CBX1; NAP1L1; UBC; TFAP4; NR2F2; THRB; ANGPTL1; NCOA1; NR3C1; ESR1; NR2F6; RARG; RXRA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NR2F6 (ARP32256_P050) antibody
Blocking Peptide For anti-NR2F6 (ARP32256_P050) antibody is Catalog # AAP32256
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR2F6
Uniprot ID P10588
Protein Name Nuclear receptor subfamily 2 group F member 6
Protein Accession # NP_005225
Purification Affinity Purified
Nucleotide Accession # NM_005234
Tested Species Reactivity Human
Gene Symbol NR2F6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 87%; Rat: 87%
Image 1
Human Jurkat
WB Suggested Anti-NR2F6 Antibody
Titration: 0.2 ug/ml
Positive Control: Jurkat Whole Cell
Image 2
Human Lung Tissue
NR2F6 antibody - N-terminal region (ARP32256_P050)
Catalog Number: ARP32256_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
Observed Staining: Nucleus of pneumocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 3
Human Liver Tissue
NR2F6 antibody - N-terminal region (ARP32256_P050)
Catalog Number: ARP32256_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Nucleus in hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 4
Human OVCAR-3 Whole Cell
Host: Rabbit
Target Name: NR2F6
Sample Tissue: Human OVCAR-3 Whole Cell
Antibody Dilution: 1ug/ml
Image 5
Human 293T Whole Cell
Host: Rabbit
Target Name: NR2F6
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com