DLX3 Antibody - N-terminal region (ARP32213_P050)

Data Sheet
 
Product Number ARP32213_P050
Product Page www.avivasysbio.com/dlx3-antibody-n-terminal-region-arp32213-p050.html
Name DLX3 Antibody - N-terminal region (ARP32213_P050)
Protein Size (# AA) 287 amino acids
Molecular Weight 32kDa
NCBI Gene Id 1747
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Distal-less homeobox 3
Alias Symbols AI4, TDO
Peptide Sequence Synthetic peptide located within the following region: SSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQT
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Maruyama,K. (2006) Calcif. Tissue Int. 78 (2), 98-102
Description of Target DLX3 is a member of the Dlx gene family which contains a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less homeo box(Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.
Protein Interactions TDP2; TBL1X; PRKCA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DLX3 (ARP32213_P050) antibody
Blocking Peptide For anti-DLX3 (ARP32213_P050) antibody is Catalog # AAP32213 (Previous Catalog # AAPP03186)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DLX3
Uniprot ID O60479
Protein Name Homeobox protein DLX-3
Protein Accession # NP_005211
Purification Affinity Purified
Nucleotide Accession # NM_005220
Tested Species Reactivity Human
Gene Symbol DLX3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Image 1
Human kidney
Rabbit Anti-DLX3 Antibody
Catalog Number: ARP32213
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Transfected 293T
WB Suggested Anti-DLX3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
Image 3
Human Placenta
Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com