Product Number |
ARP32213_P050 |
Product Page |
www.avivasysbio.com/dlx3-antibody-n-terminal-region-arp32213-p050.html |
Name |
DLX3 Antibody - N-terminal region (ARP32213_P050) |
Protein Size (# AA) |
287 amino acids |
Molecular Weight |
32kDa |
NCBI Gene Id |
1747 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Distal-less homeobox 3 |
Alias Symbols |
AI4, TDO |
Peptide Sequence |
Synthetic peptide located within the following region: SSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQT |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Maruyama,K. (2006) Calcif. Tissue Int. 78 (2), 98-102 |
Description of Target |
DLX3 is a member of the Dlx gene family which contains a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less homeo box(Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism.Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. Trichodentoosseous syndrome (TDO), an autosomal dominant condition, has been correlated with DLX3 gene mutation. This gene is located in a tail-to-tail configuration with another member of the gene family on the long arm of chromosome 17. Mutations in this gene have been associated with the autosomal dominant conditions trichodentoosseous syndrome and amelogenesis imperfecta with taurodontism. |
Protein Interactions |
TDP2; TBL1X; PRKCA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DLX3 (ARP32213_P050) antibody |
Blocking Peptide |
For anti-DLX3 (ARP32213_P050) antibody is Catalog # AAP32213 (Previous Catalog # AAPP03186) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DLX3 |
Uniprot ID |
O60479 |
Protein Name |
Homeobox protein DLX-3 |
Protein Accession # |
NP_005211 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_005220 |
Tested Species Reactivity |
Human |
Gene Symbol |
DLX3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100% |
Image 1 | Human kidney
| Rabbit Anti-DLX3 Antibody Catalog Number: ARP32213 Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
| Image 2 | Transfected 293T
| WB Suggested Anti-DLX3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Transfected 293T |
| Image 3 | Human Placenta
| Placenta |
|
|