GSH2 Antibody - N-terminal region (ARP32208_P050)

• Product Number: ARP32208_P050
• Name: GSH2 Antibody - N-terminal region (ARP32208_P050)
• Protein Size (# AA): 304 amino acids
• Molecular Weight: 32kDa
• NCBI Gene Id: 170825
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: GS homeobox 2
• Alias Symbols: GSH2, DMJDS2
• Peptide Sequence: Synthetic peptide located within the following region: MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: homeobox protein GSH-2
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-GSX2 (ARP32208_P050) antibody is Catalog # AAP32208 (Previous Catalog # AAPP28020)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GSH2
• Uniprot ID: Q9BZM3
• Protein Name: GS homeobox 2
• Protein Accession #: NP_573574
• Purification: Affinity Purified
• Nucleotide Accession #: NM_133267
• Tested Species Reactivity: Human
• Gene Symbol: GSX2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
• Image 1:
  
• Image 2: Human brain
  
  Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5ug/ml using anti-GSH2 antibody (ARP32208_P050)
• Image 3: Human HT1080 Whole Cell
  
  Host: Rabbit
  Target Name: GSX2
  Sample Tissue: Human HT1080 Whole Cell
  Antibody Dilution: 1ug/ml
• Image 4: Human Testis
  
  Host: Rabbit
  Target Name: GSH2
  Sample Type: Human Testis
  Antibody Dilution: 1.0ug/ml