| Product Number |
ARP32186_T100 |
| Product Page |
www.avivasysbio.com/klf3-antibody-n-terminal-region-arp32186-t100.html |
| Name |
KLF3 Antibody - N-terminal region (ARP32186_T100) |
| Protein Size (# AA) |
345 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
51274 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Kruppel-like factor 3 (basic) |
| Alias Symbols |
BKLF |
| Peptide Sequence |
Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Perdomo,J., et al., (2005) Mol. Cell. Biol. 25 (4), 1549-1559 |
| Description of Target |
KLF3 is a zinc finger transcription factor that is known to function as a potent transcriptional repressor |
| Protein Interactions |
LHX8; EHMT2; TRAF2; FHL3; DVL3; CTBP1; SUV39H2; KDM1A; SUMO2; CTBP2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KLF3 (ARP32186_T100) antibody |
| Blocking Peptide |
For anti-KLF3 (ARP32186_T100) antibody is Catalog # AAP32186 (Previous Catalog # AAPP03159) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human KLF3 |
| Uniprot ID |
P57682 |
| Protein Name |
Krueppel-like factor 3 |
| Sample Type Confirmation |
KLF3 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_057615 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_016531 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KLF3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 92% |
| Image 1 | Human HepG2
 | WB Suggested Anti-KLF3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysateKLF3 is supported by BioGPS gene expression data to be expressed in HepG2 |
|
|
