NT5C3 Antibody - middle region (ARP32185_P050)

Data Sheet
 
Product Number ARP32185_P050
Product Page www.avivasysbio.com/nt5c3-antibody-middle-region-arp32185-p050.html
Name NT5C3 Antibody - middle region (ARP32185_P050)
Protein Size (# AA) 336 amino acids
Molecular Weight 38kDa
NCBI Gene Id 51251
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name 5'-nucleotidase, cytosolic III
Description
Alias Symbols p36, PN-I, POMP, PSN1, UMPH, NT5C3, P5N-1, UMPH1, hUMP1, P5'N-1, cN-III
Peptide Sequence Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Amici,A., et al., (2002) Genomics Meth. Enzymol. 354,149-159
Description of Target Pyrimidine 5-prime-nucleotidase (P5N), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology. Pyrimidine 5-prime-nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2; MIM 191720). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions BAG3; VANGL1; NDUFAB1; GNAQ; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NT5C3A (ARP32185_P050) antibody
Blocking Peptide For anti-NT5C3A (ARP32185_P050) antibody is Catalog # AAP32185 (Previous Catalog # AAPP03158)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NT5C3
Uniprot ID Q9H0P0-1
Protein Name Cytosolic 5'-nucleotidase 3
Publications

The intracellular pyrimidine 5'-nucleotidase NT5C3A is a negative epigenetic factor in interferon and cytokine signaling. Sci Signal. 11, (2018). 29463777

Protein Accession # NP_057573
Purification Affinity Purified
Nucleotide Accession # NM_016489
Tested Species Reactivity Human
Gene Symbol NT5C3A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 92%
Image 1
Human HepG2
WB Suggested Anti-NT5C3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com