Product Number |
ARP32185_P050 |
Product Page |
www.avivasysbio.com/nt5c3-antibody-middle-region-arp32185-p050.html |
Name |
NT5C3 Antibody - middle region (ARP32185_P050) |
Protein Size (# AA) |
336 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
51251 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
5'-nucleotidase, cytosolic III |
Description |
|
Alias Symbols |
p36, PN-I, POMP, PSN1, UMPH, NT5C3, P5N-1, UMPH1, hUMP1, P5'N-1, cN-III |
Peptide Sequence |
Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Amici,A., et al., (2002) Genomics Meth. Enzymol. 354,149-159 |
Description of Target |
Pyrimidine 5-prime-nucleotidase (P5N), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology. Pyrimidine 5-prime-nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2; MIM 191720). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
BAG3; VANGL1; NDUFAB1; GNAQ; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-NT5C3A (ARP32185_P050) antibody |
Blocking Peptide |
For anti-NT5C3A (ARP32185_P050) antibody is Catalog # AAP32185 (Previous Catalog # AAPP03158) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human NT5C3 |
Uniprot ID |
Q9H0P0-1 |
Protein Name |
Cytosolic 5'-nucleotidase 3 |
Publications |
The intracellular pyrimidine 5'-nucleotidase NT5C3A is a negative epigenetic factor in interferon and cytokine signaling. Sci Signal. 11, (2018). 29463777 |
Protein Accession # |
NP_057573 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_016489 |
Tested Species Reactivity |
Human |
Gene Symbol |
NT5C3A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 92% |
Image 1 | Human HepG2
| WB Suggested Anti-NT5C3 Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|