RAX Antibody - N-terminal region (ARP32164_P050)

Data Sheet
 
Product Number ARP32164_P050
Product Page www.avivasysbio.com/rax-antibody-n-terminal-region-arp32164-p050.html
Name RAX Antibody - N-terminal region (ARP32164_P050)
Protein Size (# AA) 346 amino acids
Molecular Weight 37kDa
NCBI Gene Id 30062
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Retina and anterior neural fold homeobox
Alias Symbols RX, MCOP3
Peptide Sequence Synthetic peptide located within the following region: EYEAPRPYCPKEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Voronina,V.A., et al., (2004) Hum.Mol.Genet.13(3),315-322
Description of Target Retinal Homeobox Protein Rx (RAX) is a member of homeobox family of transcription factors. Mutations mouse and fish RAX lead to defects in retinal development and result in animal models of anophthalmia.
Protein Interactions PAX6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RAX (ARP32164_P050) antibody
Blocking Peptide For anti-RAX (ARP32164_P050) antibody is Catalog # AAP32164 (Previous Catalog # AAPP35527)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human RAX
Uniprot ID Q9Y2V3
Protein Name Retinal homeobox protein Rx
Protein Accession # NP_038463
Purification Affinity Purified
Nucleotide Accession # NM_013435
Tested Species Reactivity Human
Gene Symbol RAX
Predicted Species Reactivity Human, Rat, Dog, Guinea Pig
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 93%; Guinea Pig: 86%; Human: 100%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-RAX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com