Product Number |
ARP32164_P050 |
Product Page |
www.avivasysbio.com/rax-antibody-n-terminal-region-arp32164-p050.html |
Name |
RAX Antibody - N-terminal region (ARP32164_P050) |
Protein Size (# AA) |
346 amino acids |
Molecular Weight |
37kDa |
NCBI Gene Id |
30062 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Retina and anterior neural fold homeobox |
Alias Symbols |
RX, MCOP3 |
Peptide Sequence |
Synthetic peptide located within the following region: EYEAPRPYCPKEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Voronina,V.A., et al., (2004) Hum.Mol.Genet.13(3),315-322 |
Description of Target |
Retinal Homeobox Protein Rx (RAX) is a member of homeobox family of transcription factors. Mutations mouse and fish RAX lead to defects in retinal development and result in animal models of anophthalmia. |
Protein Interactions |
PAX6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-RAX (ARP32164_P050) antibody |
Blocking Peptide |
For anti-RAX (ARP32164_P050) antibody is Catalog # AAP32164 (Previous Catalog # AAPP35527) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RAX |
Uniprot ID |
Q9Y2V3 |
Protein Name |
Retinal homeobox protein Rx |
Protein Accession # |
NP_038463 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_013435 |
Tested Species Reactivity |
Human |
Gene Symbol |
RAX |
Predicted Species Reactivity |
Human, Rat, Dog, Guinea Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Guinea Pig: 86%; Human: 100%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-RAX Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|