RNF12 Antibody - C-terminal region (ARP32151_P050)

Data Sheet
 
Product Number ARP32151_P050
Product Page www.avivasysbio.com/rnf12-antibody-c-terminal-region-arp32151-p050.html
Name RNF12 Antibody - C-terminal region (ARP32151_P050)
Protein Size (# AA) 624 amino acids
Molecular Weight 69kDa
NCBI Gene Id 51132
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Ring finger protein, LIM domain interacting
Alias Symbols MRX61, RNF12, TOKAS, NY-REN-43
Peptide Sequence Synthetic peptide located within the following region: AQFFLLNEDDDDQPRGLTKEQIDNLAMRSFGENDALKTCSVCITEYTEGN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hiratani, I.,et al., (2003) Development 130 (17), 4161-4175
Description of Target RNF12 is a RING-H2 zinc finger protein. It has been shown to be a ubiquitin protein ligase that targets LIM domain binding 1 (LDB1/CLIM), and causes proteasome-dependent degradation of LDB1. This protein and LDB1 are co-repressors of LHX1/LIM-1, a homeodomain transcription factor. Alternatively spliced transcript variants encoding the same protein have been reported.
Protein Interactions STMN1; SNX17; UBC; RPS14; TNFAIP3; UBE2D1; LNX2; TERF1; SMURF2; HHV8GK18_gp81; HDAC2; REXO1; TOLLIP; LDB1; UBXN1; UBE2E2; SIAH1; SS18L1; STAT6; UBE2D4; UBE2E1; UBE2D3; UBE2D2; LDB2; SIN3A; PDLIM1; LHX1; LHX2; LIMK1; LHX3; ISL1; LMO2; RLIM; ESR1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RLIM (ARP32151_P050) antibody
Blocking Peptide For anti-RLIM (ARP32151_P050) antibody is Catalog # AAP32151 (Previous Catalog # AAPP03121)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RNF12
Uniprot ID Q9NVW2
Protein Name E3 ubiquitin-protein ligase RLIM
Sample Type Confirmation

RLIM is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_057204
Purification Affinity Purified
Nucleotide Accession # NM_016120
Tested Species Reactivity Human
Gene Symbol RLIM
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Yeast: 89%; Zebrafish: 93%
Image 1
Human Spermatophore
Human Spermatophore
Image 2
Human Jurkat
WB Suggested Anti-RNF12 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateRLIM is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com