| Product Number |
ARP32145_P050 |
| Product Page |
www.avivasysbio.com/rnf166-antibody-middle-region-arp32145-p050.html |
| Name |
Rnf166 Antibody - middle region (ARP32145_P050) |
| Protein Size (# AA) |
237 amino acids |
| Molecular Weight |
26kDa |
| NCBI Gene Id |
68718 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Ring finger protein 166 |
| Alias Symbols |
Zfp31, Zfp313l, AW555115, 1110031E24Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: PLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRAHISSCLK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Rnf166 (ARP32145_P050) antibody |
| Blocking Peptide |
For anti-Rnf166 (ARP32145_P050) antibody is Catalog # AAP32145 (Previous Catalog # AAPP23950) |
| Uniprot ID |
Q3U9F6 |
| Protein Name |
RING finger protein 166 |
| Protein Accession # |
NP_001028314 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001033142 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Rnf166 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Mouse Pancreas
 | WB Suggested Anti-Rnf166 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Pancreas |
|
|
