MYF5 Antibody - N-terminal region (ARP32134_P050)

Data Sheet
 
Product Number ARP32134_P050
Product Page www.avivasysbio.com/myf5-antibody-n-terminal-region-arp32134-p050.html
Name MYF5 Antibody - N-terminal region (ARP32134_P050)
Protein Size (# AA) 255 amino acids
Molecular Weight 28kDa
NCBI Gene Id 4617
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Myogenic factor 5
Alias Symbols EORVA, bHLHc2
Peptide Sequence Synthetic peptide located within the following region: ACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Roy,K., et al., (2002) J.Biol.Chem.277(37),33818-33824
Description of Target MYF5 is a member of the myogenic basic helix-loop-helix family of transcription factors, which can activate the muscle differentiation program.
Protein Interactions ELSPBP1; ID1; MDFI; ID2; ID3; MYF5; TCF3; CSNK2A2; CSNK2A1; CALM3; CALM1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MYF5 (ARP32134_P050) antibody
Blocking Peptide For anti-MYF5 (ARP32134_P050) antibody is Catalog # AAP32134 (Previous Catalog # AAPP03076)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MYF5
Uniprot ID P13349
Protein Name Myogenic factor 5
Publications

Yang, Z. et al. Mononuclear cells from dedifferentiation of mouse myotubes display remarkable regenerative capability. Stem Cells 32, 2492-501 (2014). 24916688

Protein Accession # NP_005584
Purification Affinity Purified
Nucleotide Accession # NM_005593
Tested Species Reactivity Human, Mouse
Gene Symbol MYF5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 93%
Image 1
Mouse heart, mouse skeletal muscle
Lanes:
1: Mouse heart lysate, 2: Mouse skeletal muscle lysate
Primary Antibody Dilution:
1:1000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:10000
Gene Name:
MYF5
Submitted by:
Anonymous
Image 2
Human Jurkat
WB Suggested Anti-MYF5 Antibody
Titration: 1 ug/ml
Positive Control: Human Jurkat Cell
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com