| Product Number |
ARP32076_T100 |
| Product Page |
www.avivasysbio.com/znf691-antibody-n-terminal-region-arp32076-t100.html |
| Name |
ZNF691 Antibody - N-terminal region (ARP32076_T100) |
| Protein Size (# AA) |
284 amino acids |
| Molecular Weight |
33kDa |
| NCBI Gene Id |
51058 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 691 |
| Alias Symbols |
Zfp691 |
| Peptide Sequence |
Synthetic peptide located within the following region: GSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKEHGQESLSDELQE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
| Description of Target |
ZNF691 may be involved in transcriptional regulation |
| Protein Interactions |
UBC; HAP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF691 (ARP32076_T100) antibody |
| Blocking Peptide |
For anti-ZNF691 (ARP32076_T100) antibody is Catalog # AAP32076 (Previous Catalog # AAPP02978) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF691 |
| Uniprot ID |
Q5VV52-2 |
| Protein Name |
Zinc finger protein 691 |
| Protein Accession # |
NP_056995 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_015911 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF691 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 83%; Horse: 83%; Human: 100%; Mouse: 83%; Pig: 92%; Rabbit: 83%; Rat: 92% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-ZNF691 Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T |
|
|
