MYEF2 Antibody - N-terminal region (ARP32065_P050)

Data Sheet
 
Product Number ARP32065_P050
Product Page www.avivasysbio.com/myef2-antibody-n-terminal-region-arp32065-p050.html
Name MYEF2 Antibody - N-terminal region (ARP32065_P050)
Protein Size (# AA) 600 amino acids
Molecular Weight 64kDa
NCBI Gene Id 50804
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Myelin expression factor 2
Alias Symbols MEF-2, MST156, myEF-2, MSTP156, HsT18564
Peptide Sequence Synthetic peptide located within the following region: PAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gossett,L.A., (1989) Mol. Cell. Biol. 9 (11), 5022-5033
Description of Target MYEF2 is the transcriptional repressor of the myelin basic protein gene (MBP). MYEF2 binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.
Protein Interactions COG8; TEX11; TRAF1; GOLGA2; UBC; EED; RNF2; BMI1; SOX2; CDK19; SIRT7; TADA2A; ATXN1; PPARGC1A; HDAC5; MAPK14; tat; SMARCA4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MYEF2 (ARP32065_P050) antibody
Blocking Peptide For anti-MYEF2 (ARP32065_P050) antibody is Catalog # AAP32065 (Previous Catalog # AAPP02967)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MYEF2
Uniprot ID Q9P2K5
Protein Name Myelin expression factor 2
Protein Accession # NP_057216
Purification Affinity Purified
Nucleotide Accession # NM_016132
Tested Species Reactivity Human
Gene Symbol MYEF2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 77%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human PANC1
WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: PANC1 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com