PAWR Antibody - middle region (ARP32062_P050)

Data Sheet
 
Product Number ARP32062_P050
Product Page www.avivasysbio.com/pawr-antibody-middle-region-arp32062-p050.html
Name PAWR Antibody - middle region (ARP32062_P050)
Protein Size (# AA) 340 amino acids
Molecular Weight 37kDa
NCBI Gene Id 5074
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name PRKC, apoptosis, WT1, regulator
Alias Symbols PAR4, Par-4
Peptide Sequence Synthetic peptide located within the following region: VNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bergmann,M., et al., (2004) Ann.Hematol.83(10),646-653
Description of Target The tumor suppressor WT1 represses and activates transcription. Anti-Prostate Apoptosis Response Protein Par-4 (PAWR) is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells.
Protein Interactions FBXO45; UBC; EED; FAM129B; SNX6; CAND1; VPS29; JMJD6; STAT1; SNX2; SHMT2; SHMT1; PPM1G; IDE; H3F3A; CARS; ATP6V1C1; APEH; PAN2; DRD2; DAPK3; SQSTM1; PRKCZ; Spsb4; Spsb2; SPSB1; FBXO25; HSPA5; Cep350; Kif23; THAP1; SLC5A7; AATF; TFPT; PAWR; WT1; RRAS2; ATP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PAWR (ARP32062_P050) antibody
Blocking Peptide For anti-PAWR (ARP32062_P050) antibody is Catalog # AAP32062 (Previous Catalog # AAPP02964)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PAWR
Uniprot ID O75796
Protein Name PRKC apoptosis WT1 regulator protein
Protein Accession # NP_002574
Purification Affinity Purified
Nucleotide Accession # NM_002583
Tested Species Reactivity Human, Rat
Gene Symbol PAWR
Predicted Species Reactivity Human, Mouse, Rat, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-PAWR Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Image 2
Human Muscle
Human Muscle
Image 3
rat striatum homogenate
WB Suggested Anti-PAWR Antibody
Positive Control: Lane 1: 30ug rat striatum homogenate
Primary Antibody Dilution : 1:1000
Secondary Antibody : Anti rabbit-HRP
Secondry Antibody Dilution : 1:10,000
Submitted by: Kristy Shimp, University of Florida
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com